Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

Recombinant Human Androgen receptor (AR), partial

Product Specifications

Product Name Alternative

Dihydrotestosterone receptor; Nuclear receptor subfamily 3 group C member 4

UniProt

P10275

Expression Region

551-919aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.107.

AA Sequence

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUR 61414
TRC-C835000-5MG 5 mg

CUR 61414

Sign In for Pricing
View Details
2-Heptyl Chloroformate
TRC-H282990-2.5G 2.5 g

2-Heptyl Chloroformate

Sign In for Pricing
View Details
2',6'-Dichloroacetanilide
TRC-D431615-500MG 500 mg

2',6'-Dichloroacetanilide

Sign In for Pricing
View Details
EGFR Antibody (phospho-Y1069)
F48475-0.08ML 0.08 mL

EGFR Antibody (phospho-Y1069)

Sign In for Pricing
View Details
PLK1 (Ab-210) Antibody
8B0554-AAT 50 µg

PLK1 (Ab-210) Antibody

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (rPTPRC/1132), CF647 conjugate, 0.1mg/mL
BNC473461-500 1x 500 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details