Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2-microglobulin (B2M)

Recombinant Cat Beta-2-microglobulin (B2M)

Product Specifications

Product Name Alternative

B2M

UniProt

Q5MGS7

Expression Region

21-118aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-Methoxypiperidin-1-yl) propan-2-ol
JXB11022-01 50 mg

1- (4-Methoxypiperidin-1-yl) propan-2-ol

Sign In for Pricing
View Details
1- (4-Methoxypiperidin-1-yl) propan-2-ol
JXB11022-02 0.5 g

1- (4-Methoxypiperidin-1-yl) propan-2-ol

Sign In for Pricing
View Details
Hu_MICA CHO-S Cell Line
E33C100046 1 Vial

Hu_MICA CHO-S Cell Line

Sign In for Pricing
View Details
IL3RA Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2600R-BF555-01 20 µL

IL3RA Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
IL3RA Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2600R-BF555-02 100 µL

IL3RA Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
FASTK Peptide - N-terminal region
orb2000805 100 µg

FASTK Peptide - N-terminal region

Sign In for Pricing
View Details