Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

UniProt

Q69YS8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nuclear receptor coactivator 1 (NCOA1) ELISA Kit
RK06634 96 Tests

Mouse Nuclear receptor coactivator 1 (NCOA1) ELISA Kit

Sign In for Pricing
View Details
Canine LRP1 ELISA Kit
ECL0285 96 Tests

Canine LRP1 ELISA Kit

Sign In for Pricing
View Details
SYNC Antibody
OACD07573-1ML 1 mL

SYNC Antibody

Sign In for Pricing
View Details
DNAI2 antibody
70R-13045 100 µL

DNAI2 antibody

Sign In for Pricing
View Details
Human GA Binding Protein Transcription Factor Alpha (GABPa) Protein
abx165892-01 10 µg

Human GA Binding Protein Transcription Factor Alpha (GABPa) Protein

Sign In for Pricing
View Details
Human GA Binding Protein Transcription Factor Alpha (GABPa) Protein
abx165892-02 50 µg

Human GA Binding Protein Transcription Factor Alpha (GABPa) Protein

Sign In for Pricing
View Details