Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Expression Region

984-1040aa

Tag

N-terminal 6xHis-NusA-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YF438
HY-164550 1 Each

YF438

Sign In for Pricing
View Details
Cytochrome P450 1A1 (CYP1A1) Antibody
abx431195 200 µL

Cytochrome P450 1A1 (CYP1A1) Antibody

Sign In for Pricing
View Details
Mouse Rpa1 ELISA KIT
ELI-30131m 96 Tests

Mouse Rpa1 ELISA KIT

Sign In for Pricing
View Details
Human WHAMM activation kit by CRISPRa
GA114814 1 Kit

Human WHAMM activation kit by CRISPRa

Sign In for Pricing
View Details
LZTR1 Antibody - N-terminal region : HRP (ARP38862_P050-HRP)
ARP38862_P050-HRP 100 µL

LZTR1 Antibody - N-terminal region : HRP (ARP38862_P050-HRP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 12 Receptor Beta 2 (IL12Rb2)
MBS2051250-01 0.1 mL

FITC-Linked Polyclonal Antibody to Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details