Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76)

This Recombinant Human T cell receptor beta variable 7-6 (TVB76) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE12 3'UTR Lenti-reporter-Luc Vector
36276081 1.0 µg

PDE12 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
EVX2 Rabbit Polyclonal Antibody (Biotin)
orb2126248 100 µL

EVX2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal TRBP Antibody [mFluor Violet 610 SE]
NBP2-98056MFV610 0.1 mL

Rabbit Polyclonal TRBP Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lama1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4335605 3x 1.0 µg

Lama1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse C1galt1 Pre-designed siRNA Set A
SI101621A 1 Each

Mouse C1galt1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
EGFR (Phospho-Ser695) Rabbit mAb Antibody
orb1727752-01 50 µL

EGFR (Phospho-Ser695) Rabbit mAb Antibody

Sign In for Pricing
View Details