Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (Biotin)

EVX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EVX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Olfactory receptor 5M10 (OR5M10) ELISA kit
GTR10443060 96 Well

Canine Olfactory receptor 5M10 (OR5M10) ELISA kit

Sign In for Pricing
View Details
TGF-beta (Transforming Growth Factor beta) (TGFB/510), CF640R conjugate, 0.1mg/mL
BNC400510-100 1x 100 µL

TGF-beta (Transforming Growth Factor beta) (TGFB/510), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Fruit fly Agps Antibody Fluoro488 Conjugated
DZ41779-Fluoro488 200 µL/Vial

Anti-Fruit fly Agps Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)
MBS2078861-01 0.1 mL

APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)
MBS2078861-02 0.2 mL

APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)
MBS2078861-03 0.5 mL

APC-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L3 (UCHL3)

Sign In for Pricing
View Details