Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP)

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome α3 rabbit pAb
ES20222-01 50 µL

Proteasome α3 rabbit pAb

Sign In for Pricing
View Details
Proteasome α3 rabbit pAb
ES20222-02 100 µL

Proteasome α3 rabbit pAb

Sign In for Pricing
View Details
CEP112 Polyclonal Antibody
orb616145-01 50 μL

CEP112 Polyclonal Antibody

Sign In for Pricing
View Details
CEP112 Polyclonal Antibody
orb616145-02 100 µL

CEP112 Polyclonal Antibody

Sign In for Pricing
View Details
4- (Thien-2-yl) phenacyl bromide
OR9681-01 50 mg

4- (Thien-2-yl) phenacyl bromide

Sign In for Pricing
View Details
4- (Thien-2-yl) phenacyl bromide
OR9681-02 250 mg

4- (Thien-2-yl) phenacyl bromide

Sign In for Pricing
View Details