Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1)

This Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1) spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative Wilms tumor upstream neighbor 1 gene protein; WIT-1; Wilms tumor-associated antisense RNA; WT1-AS WIT1

UniProt

Q06250

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis [2-[ (2-Amino-1,6-dihydro-6-O-benzyl-9H-purin-9yl) methoxy]ethanol]
004035 1 mg

Bis [2-[ (2-Amino-1,6-dihydro-6-O-benzyl-9H-purin-9yl) methoxy]ethanol]

Sign In for Pricing
View Details
LCN15 Rabbit Polyclonal Antibody (BF555)
orb2482689 100 µL

LCN15 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
LOC100363289 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6234603 1.0 µg DNA

LOC100363289 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD (A344S) -His Recombinant Protein
PH0169M166 100 µg

SARS-CoV-2 Spike RBD (A344S) -His Recombinant Protein

Sign In for Pricing
View Details
Anti-Elf-4 antibody
STJ92889 200 µl

Anti-Elf-4 antibody

Sign In for Pricing
View Details
Recombinant Rat Calnexin (Canx)
orb2902178-01 20 µg

Recombinant Rat Calnexin (Canx)

Sign In for Pricing
View Details