Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Calnexin (Canx)

This Recombinant Rat Calnexin (Canx) spans the amino acid sequence from region 21-591.

Product Specifications

Product Name Alternative

Calnexin

UniProt

P35565

Expression Region

21-591

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HDGHDDDMIDIEDDLDDVIEEVEDSKSKSDTSTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKGDEEEEEEKLEEKQKSDAEEDGGTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLT1B (NM_016072) Human Tagged Lenti ORF Clone
RC201871L3 10 µg

GOLT1B (NM_016072) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PEBP4 AAV Vector (Human) (CMV)
36369101 1 µg

PEBP4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
[Met5, Arg6, Gly7, Leu8] Enkephalin
M41139-01 100 mg

[Met5, Arg6, Gly7, Leu8] Enkephalin

Sign In for Pricing
View Details
[Met5, Arg6, Gly7, Leu8] Enkephalin
M41139-02 25 mg

[Met5, Arg6, Gly7, Leu8] Enkephalin

Sign In for Pricing
View Details
[Met5, Arg6, Gly7, Leu8] Enkephalin
M41139-03 50 mg

[Met5, Arg6, Gly7, Leu8] Enkephalin

Sign In for Pricing
View Details
[Met5, Arg6, Gly7, Leu8] Enkephalin
M41139-04 500 mg

[Met5, Arg6, Gly7, Leu8] Enkephalin

Sign In for Pricing
View Details