Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUG-BP1/2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2513378 100 µL

CUG-BP1/2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
KRISHGEN rcAAV-5/N Quantitation RT-PCR Kit
KBPL9012 200 Reactions

KRISHGEN rcAAV-5/N Quantitation RT-PCR Kit

Sign In for Pricing
View Details
Human SCN2A qPCR Primer Pair
QH22285S 200 Tests

Human SCN2A qPCR Primer Pair

Sign In for Pricing
View Details
9830107B12Rik (NM_001177897) Mouse Untagged Clone
MC214542 10 µg

9830107B12Rik (NM_001177897) Mouse Untagged Clone

Sign In for Pricing
View Details
L-Tryptophan methyl ester
orb3159153 20 mg

L-Tryptophan methyl ester

Sign In for Pricing
View Details
Sheep COMM domain containing protein 9 (COMMD9) ELISA Kit
GTR10354318 96 Well

Sheep COMM domain containing protein 9 (COMMD9) ELISA Kit

Sign In for Pricing
View Details