Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMA1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1216104 1.0 µg DNA

LIMA1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Glycididazole (sodium)
HY-16459 1 Each

Glycididazole (sodium)

Sign In for Pricing
View Details
ALG1L ORF Vector (Human) (pORF)
11762011 1.0 µg DNA

ALG1L ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Foxp4 qPCR Primer Pair
QM42618S 200 Tests

Mouse Foxp4 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Human Desmoplakin (DSP), partial
orb1653132-01 20 µg

Recombinant Human Desmoplakin (DSP), partial

Sign In for Pricing
View Details
Recombinant Human Desmoplakin (DSP), partial
orb1653132-02 100 µg

Recombinant Human Desmoplakin (DSP), partial

Sign In for Pricing
View Details