Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apelin receptor early endogenous ligand (ELA)

This Recombinant Human Apelin receptor early endogenous ligand (ELA) spans the amino acid sequence from region 23-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apelin receptor early endogenous ligand; Protein Elabela; ELA; Protein Toddler; APELA ELA TDL

UniProt

P0DMC3

Expression Region

23-54

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf63 CRISPR Knock Out 293T Cell Line (Human)
13931141 1x 10^6 Cells / 1.0 mL

C16orf63 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mup15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3194205 3x 1.0 µg

Mup15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) polyclonal Antibody
MBS713542-01 0.1 mL

Rabbit anti-human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) polyclonal Antibody
MBS713542-02 5x 0.1 mL

Rabbit anti-human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) polyclonal Antibody

Sign In for Pricing
View Details
Anti-NOS2A
Y080023 100 µL

Anti-NOS2A

Sign In for Pricing
View Details
Lentiviral mouse Hnrnpul2 shRNA (UAS) - Lentiviral mouse Hnrnpul2 shRNA (UAS, RFP) plasmid
GTR15201577 1 Vial

Lentiviral mouse Hnrnpul2 shRNA (UAS) - Lentiviral mouse Hnrnpul2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details