Recombinant Human Choriogonadotropin subunit beta 3 (CGB3)
This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3) spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Choriogonadotropin subunit beta 3; Choriogonadotropin subunit beta; CG-beta; Chorionic gonadotropin chain beta; CGB3 CGB; CGB5; CGB8
UniProt
P0DN86
Expression Region
21-165
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0841402 1.0 µg DNA
GAS2 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
orb2933284-01 20 µg
Recombinant Ceratophyllum demersum NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic
Sign In for Pricing
View Details orb2933284-02 100 µg
Recombinant Ceratophyllum demersum NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic
Sign In for Pricing
View Details 