Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clathrin heavy chain 1 (CLH1), partial

This Recombinant Human Clathrin heavy chain 1 (CLH1), partial spans the amino acid sequence from region 1-364. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Clathrin heavy chain 1; Clathrin heavy chain on chromosome 17; CLH-17; CLTC CLH17 CLTCL2 KIAA0034

UniProt

Q00610

Expression Region

1-364

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin β I shRNA (h) Lentiviral Particles
sc-36547-V 200 µL

Spectrin β I shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
LOC100039444 3'UTR Luciferase Stable Cell Line
TU111167 1.0 mL

LOC100039444 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GPR89C Protein Vector (Human) (pPB-C-His)
PV081557 500 ng

GPR89C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human uPAR Protein
orb2995110-01 10 µg

Recombinant Human uPAR Protein

Sign In for Pricing
View Details
Recombinant Human uPAR Protein
orb2995110-02 50 µg

Recombinant Human uPAR Protein

Sign In for Pricing
View Details
Recombinant Human uPAR Protein
orb2995110-03 500 µg

Recombinant Human uPAR Protein

Sign In for Pricing
View Details