Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAV12-2 ORF Vector (Human) (pORF)
ORF034300 1.0 µg DNA

TRAV12-2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Atf2 Rat Pre-designed siRNA Set A
HY-RS23446 1 Set

Atf2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-NDUFB8 Antibody Picoband®, FITC Conjugate
A07936-1-FITC 100 µg/Vial

Anti-NDUFB8 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
FCHO1
562507-01 50 µg

FCHO1

Sign In for Pricing
View Details
FCHO1
562507-02 100 µg

FCHO1

Sign In for Pricing
View Details
MRP-L17 Lentiviral Activation Particles (h2)
sc-412956-LAC-2 200 µL

MRP-L17 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details