Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 2A1 (ST2A1)

This Recombinant Human Sulfotransferase 2A1 (ST2A1) spans the amino acid sequence from region 1-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sulfotransferase 2A1; ST2A1; EC 2.8.2.2; Bile salt sulfotransferase; EC 2.8.2.14; Dehydroepiandrosterone sulfotransferase; DHEA-ST; DHEA-ST8; Hydroxysteroid Sulfotransferase; HST; ST2; SULT2A3; SULT2A1 HST STD

UniProt

Q06520

Expression Region

1-285

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(3-Thienyl)acrylic Acid
TRC-T430030-50MG 50 mg

3-(3-Thienyl)acrylic Acid

Sign In for Pricing
View Details
Human CTGF Recombinant Rabbit monoclonal Antibody
HA723375H 100 µL

Human CTGF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PD1 Monoclonal Antibody
AN301420L-01 50 µL

Recombinant PD1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PD1 Monoclonal Antibody
AN301420L-02 100 µL

Recombinant PD1 Monoclonal Antibody

Sign In for Pricing
View Details
Ttc6 Mouse Gene Knockout Kit (CRISPR)
KN500338 1 Kit

Ttc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MD2 (LY96) activation kit by CRISPRa
GA108455 1 Kit

Human MD2 (LY96) activation kit by CRISPRa

Sign In for Pricing
View Details