Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Periostin (POSTN), partial

This Recombinant Human Periostin (POSTN), partial spans the amino acid sequence from region 97-230. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Periostin; PN; Osteoblast-specific factor 2; OSF-2; POSTN OSF2

UniProt

Q15063

Expression Region

97-230

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200R1L, NT (CD200R1L, CD200R2, Cell surface glycoprotein CD200 receptor 2, CD200 cell surface glycoprotein receptor-like 2, CD200 cell surface glycoprotein receptor-like a, Cell surface glycoprotein CD200 receptor 1-like, Cell surface glycoprotein OX2 receptor 2) (Azide free) (HRP) discontinued
033476-HRP 200 µL

CD200R1L, NT (CD200R1L, CD200R2, Cell surface glycoprotein CD200 receptor 2, CD200 cell surface glycoprotein receptor-like 2, CD200 cell surface glycoprotein receptor-like a, Cell surface glycoprotein CD200 receptor 1-like, Cell surface glycoprotein OX2 receptor 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-ATP6V1A Antibody Picoband® (Dylight488 Conjugate)
A10401-2-Dylight488 100 µg

Anti-ATP6V1A Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Ethyl 2- (4- (((phenylcarbonylamino) thioxomethyl) amino) -3,5-thiazolyl) acetate
FE170013 250 mg

Ethyl 2- (4- (((phenylcarbonylamino) thioxomethyl) amino) -3,5-thiazolyl) acetate

Sign In for Pricing
View Details
PPP2CA discontinued
513058 100 µg

PPP2CA discontinued

Sign In for Pricing
View Details
Vidarabine monohydrate
S5297-25mg 25 mg

Vidarabine monohydrate

Sign In for Pricing
View Details
PRSS42 Peptide - C-terminal region
orb2003261 100 µg

PRSS42 Peptide - C-terminal region

Sign In for Pricing
View Details