Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS42 Peptide - C-terminal region

PRSS42 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRSS42, TESSP2

UniProt

Q7Z5A4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS42 Rabbit Polyclonal Antibody (orb587722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_874361

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSNIQPICIPQENFQVEGRTRCWVTGWGKTPEREKLASEILQDVDQYIMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX2 Human Gene Knockout Kit (CRISPR)
KN401621 1 Kit

SNX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-tert-Butyl-4-aminobenzenesulfonamide
TRC-B690795-50G 50 g

N-tert-Butyl-4-aminobenzenesulfonamide

Sign In for Pricing
View Details
TMPRSS2 Polyclonal Antibody
E-AB-61783-01 60 µL

TMPRSS2 Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS2 Polyclonal Antibody
E-AB-61783-02 120 µL

TMPRSS2 Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS2 Polyclonal Antibody
E-AB-61783-03 200 µL

TMPRSS2 Polyclonal Antibody

Sign In for Pricing
View Details
CCM2 (NM_001167935) Human Over-expression Lysate
LY432927 100 µg

CCM2 (NM_001167935) Human Over-expression Lysate

Sign In for Pricing
View Details