Recombinant Human PAT complex subunit Asterix (ASTER), partial
This Recombinant Human PAT complex subunit Asterix (ASTER), partial spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008
UniProt
Q9Y284
Expression Region
2-32
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
STNNMSDPRRPNKVLRYKPPPSECNPALDDP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
248525-FITC 100 µL
MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (FITC)
Sign In for Pricing
View Details