Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial

This Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial spans the amino acid sequence from region 62-196. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Signaling threshold-regulating transmembrane adapter 1; SHP2-interacting transmembrane adapter protein; Suppression-inducing transmembrane adapter 1; gp30/40; SIT1 SIT

UniProt

Q9Y3P8

Expression Region

62-196

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP8L Human qPCR Primer Pair (NM_014371)
HP210835 200 Reactions

AKAP8L Human qPCR Primer Pair (NM_014371)

Sign In for Pricing
View Details
SNAG1 Peptide - middle region
orb2008934 100 µg

SNAG1 Peptide - middle region

Sign In for Pricing
View Details
SLAMF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43854156 3x 1.0 µg DNA

SLAMF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis ATR-interacting protein (ATRIP), partial
MBS1359349 Inquire

Recombinant Macaca fascicularis ATR-interacting protein (ATRIP), partial

Sign In for Pricing
View Details
WNK1 shRNA Plasmid (h2)
sc-96133-SH 20 µg

WNK1 shRNA Plasmid (h2)

Sign In for Pricing
View Details
ATG13, phosphorylated (S355) (ATG13, KIAA0652, Autophagy-related protein 13) (AP) discontinued
032173-AP 200 µL

ATG13, phosphorylated (S355) (ATG13, KIAA0652, Autophagy-related protein 13) (AP) discontinued

Sign In for Pricing
View Details