Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAG1 Peptide - middle region

SNAG1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11997, FLJ32560, FLJ61062, MGC150827, MGC150829, SH3PX2, SH3PXD3B, SNAG1

UniProt

Q96RF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNAG1 Rabbit Polyclonal Antibody (orb326276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096045

Preservative

Lyophilized powder

AA Sequence

QCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKM2 Rabbit Polyclonal Antibody (BF350)
orb1582857 100 µL

PKM2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (MaxLight 750)
MBS6238455-01 0.1 mL

GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (MaxLight 750)

Sign In for Pricing
View Details
GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (MaxLight 750)
MBS6238455-02 5x 0.1 mL

GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Human SLC34A2/NaPi2b Antibody
MBS1569932-01 0.05 mg

Anti-Human SLC34A2/NaPi2b Antibody

Sign In for Pricing
View Details
Anti-Human SLC34A2/NaPi2b Antibody
MBS1569932-02 0.1 mg

Anti-Human SLC34A2/NaPi2b Antibody

Sign In for Pricing
View Details
Anti-Human SLC34A2/NaPi2b Antibody
MBS1569932-03 5x 0.1 mg

Anti-Human SLC34A2/NaPi2b Antibody

Sign In for Pricing
View Details