Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF568 conjugate, 0.1mg/mL
BNC682276-500 1x 500 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Duck Intercellular Adhesion Molecule 2 ELISA Kit
MBS075045 Inquire

Duck Intercellular Adhesion Molecule 2 ELISA Kit

Sign In for Pricing
View Details
GTPBP1 (FITC)
564469-01 50 µg

GTPBP1 (FITC)

Sign In for Pricing
View Details
GTPBP1 (FITC)
564469-02 100 µg

GTPBP1 (FITC)

Sign In for Pricing
View Details
CIB1 Rabbit pAb, BF700 conjugated
orb2873585 100 µL

CIB1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
SOST Peptide - C-terminal region
orb2000167 100 µg

SOST Peptide - C-terminal region

Sign In for Pricing
View Details