Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST Peptide - C-terminal region

SOST Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDD, VBCH, DAND6, SOST1

UniProt

Q9BQB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOST Rabbit Polyclonal Antibody (orb585686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079513

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMNL1 antibody
70R-17328 50 ul

FMNL1 antibody

Sign In for Pricing
View Details
Olfr132 Protein Vector (Mouse) (pPB-C-His)
PV208958 500 ng

Olfr132 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Histone H2A.X (Phospho-Ser139)
orb1139980 100 µg

Anti-Histone H2A.X (Phospho-Ser139)

Sign In for Pricing
View Details
DMWD (Dystrophia Myotonica WD Repeat-containing Protein, Dystrophia Myotonica-containing WD Repeat Motif Protein, Protein 59, Protein DMR-N9, DM9) (MaxLight 650)
MBS6221851-01 0.1 mL

DMWD (Dystrophia Myotonica WD Repeat-containing Protein, Dystrophia Myotonica-containing WD Repeat Motif Protein, Protein 59, Protein DMR-N9, DM9) (MaxLight 650)

Sign In for Pricing
View Details
DMWD (Dystrophia Myotonica WD Repeat-containing Protein, Dystrophia Myotonica-containing WD Repeat Motif Protein, Protein 59, Protein DMR-N9, DM9) (MaxLight 650)
MBS6221851-02 5x 0.1 mL

DMWD (Dystrophia Myotonica WD Repeat-containing Protein, Dystrophia Myotonica-containing WD Repeat Motif Protein, Protein 59, Protein DMR-N9, DM9) (MaxLight 650)

Sign In for Pricing
View Details
Prl7d1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
37698064 1.0 µg DNA

Prl7d1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details