Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piercer of microtubule wall 2 protein (PIRC2)

This Recombinant Human Piercer of microtubule wall 2 protein (PIRC2) spans the amino acid sequence from region 1-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Piercer of microtubule wall 2 protein PIERCE2 C15orf65

UniProt

H3BRN8

Expression Region

1-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1ORF94 Adenovirus (Human)
14235051 1.0 mL

C1ORF94 Adenovirus (Human)

Sign In for Pricing
View Details
DOK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA503303BM 100 µL

DOK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Recombinant human DNMT3L protein
ATGP2634-020 20 µg

Recombinant human DNMT3L protein

Sign In for Pricing
View Details
HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (MaxLight 490) discontinued
036481-ML490 100 µL

HDAC7, CT (HDAC7, HDAC7A, Histone deacetylase 7, Histone deacetylase 7A) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rauvotetraphylline D
TN7297-01 10 mg

Rauvotetraphylline D

Sign In for Pricing
View Details
Rauvotetraphylline D
TN7297-02 50 mg

Rauvotetraphylline D

Sign In for Pricing
View Details