Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal MAPK8 / JNK1 / JNK Antibody (clone 3H2), Clone: 3H2
AMM02119G 0.05mg

Monoclonal MAPK8 / JNK1 / JNK Antibody (clone 3H2), Clone: 3H2

Sign In for Pricing
View Details
HEBP1 Protein Vector (Rat) (pPM-C-HA)
PV272536 500 ng

HEBP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (MaxLight 650) discontinued
T8195-90D-ML650 100 µL

Transcription Factor YY1 (CF1, Delta Transcription Factor, NF E1, NF-E1, Transcriptional Repressor Protein YY1, UCR Motif DNA Binding Protein, UCRBP, Yin and Yang 1, Yin Yang 1, Yin-Yang 1, YY 1, YY1, YY-1, YY1 Transcription Factor) (MaxLight 650) discontinued

Sign In for Pricing
View Details
COMMD2 Antibody
OACA05230-100UG 100 µg

COMMD2 Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)
orb2934817-01 20 µg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)
orb2934817-02 100 µg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

Sign In for Pricing
View Details