Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

P0C948

Expression Region

1-100

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO32 (F-box Protein 32, Fbx32, MAFbx, F-box Only Protein 32) (PE)
MBS6446513-01 0.1 mL

FBXO32 (F-box Protein 32, Fbx32, MAFbx, F-box Only Protein 32) (PE)

Sign In for Pricing
View Details
FBXO32 (F-box Protein 32, Fbx32, MAFbx, F-box Only Protein 32) (PE)
MBS6446513-02 5x 0.1 mL

FBXO32 (F-box Protein 32, Fbx32, MAFbx, F-box Only Protein 32) (PE)

Sign In for Pricing
View Details
BRE Antibody
OAAJ05558-100UL 100 µL

BRE Antibody

Sign In for Pricing
View Details
Mouse IgM (mu chain) Antibody Rhodamine Conjugated
orb347498 1.5 mg

Mouse IgM (mu chain) Antibody Rhodamine Conjugated

Sign In for Pricing
View Details
Goat anti-MSI2 / musashi-2 (aa33-43) Antibody
dAP-3170 50 µg

Goat anti-MSI2 / musashi-2 (aa33-43) Antibody

Sign In for Pricing
View Details
Gm13271 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3808502 1.0 µg DNA

Gm13271 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details