Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO-K1/HEK293 Cells Stable expressing GPCR protein PTGDR (Protein accession # NM_000953)
cAP-1355 1 Frozen Vial

CHO-K1/HEK293 Cells Stable expressing GPCR protein PTGDR (Protein accession # NM_000953)

Sign In for Pricing
View Details
CNGA4 discontinued
530425-01 20 µL

CNGA4 discontinued

Sign In for Pricing
View Details
CNGA4 discontinued
530425-02 100 µL

CNGA4 discontinued

Sign In for Pricing
View Details
Dapagliflozin-3-O-β-D-Glucuronide
T35619-01 500 µg

Dapagliflozin-3-O-β-D-Glucuronide

Sign In for Pricing
View Details
Dapagliflozin-3-O-β-D-Glucuronide
T35619-02 1 mg

Dapagliflozin-3-O-β-D-Glucuronide

Sign In for Pricing
View Details
SNF8, NT (SNF8, EAP30, Vacuolar-sorting protein SNF8, ELL-associated protein of 30kD, ESCRT-II complex subunit VPS22) (MaxLight 405) discontinued
042086-ML405 100 µL

SNF8, NT (SNF8, EAP30, Vacuolar-sorting protein SNF8, ELL-associated protein of 30kD, ESCRT-II complex subunit VPS22) (MaxLight 405) discontinued

Sign In for Pricing
View Details