Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18)

This Recombinant Human T cell receptor beta variable 18 (TVB18) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tamarindus indica seed Extract
C02711-5mg 5 mg

Tamarindus indica seed Extract

Sign In for Pricing
View Details
EIF3F Antibody
OAAN02098-50UL 50 µL

EIF3F Antibody

Sign In for Pricing
View Details
GPT2 Human
OM299977-01 10 µg

GPT2 Human

Sign In for Pricing
View Details
GPT2 Human
OM299977-02 2 µg

GPT2 Human

Sign In for Pricing
View Details
GPT2 Human
OM299977-03 1 mg

GPT2 Human

Sign In for Pricing
View Details
ASN06917370
HY-111323-01 5 mg

ASN06917370

Sign In for Pricing
View Details