Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (1H-Pyrazol-1-yl) pyridine- 4-boronic acid pinacol ester
CSB-DT4695 1 g

2- (1H-Pyrazol-1-yl) pyridine- 4-boronic acid pinacol ester

Sign In for Pricing
View Details
N-Fmoc-O-[2-acetamido-3-O-acetyl-4,6-O-benzylidene-2-deoxy-alpha-D-galactopyranosyl]-L-threonine Allyl Ester
MBS6102536-01 5 mg

N-Fmoc-O-[2-acetamido-3-O-acetyl-4,6-O-benzylidene-2-deoxy-alpha-D-galactopyranosyl]-L-threonine Allyl Ester

Sign In for Pricing
View Details
N-Fmoc-O-[2-acetamido-3-O-acetyl-4,6-O-benzylidene-2-deoxy-alpha-D-galactopyranosyl]-L-threonine Allyl Ester
MBS6102536-02 5x 5 mg

N-Fmoc-O-[2-acetamido-3-O-acetyl-4,6-O-benzylidene-2-deoxy-alpha-D-galactopyranosyl]-L-threonine Allyl Ester

Sign In for Pricing
View Details
7-keto-25-Hydroxycholesterol
HY-133974 1 mg

7-keto-25-Hydroxycholesterol

Sign In for Pricing
View Details
Lentiviral human CLSPN sgRNA gene knockout kit - Lentiviral human CLSPN sgRNA gene knockout kit (plasmid)
GTR15362840 1 Vial

Lentiviral human CLSPN sgRNA gene knockout kit - Lentiviral human CLSPN sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human OMD ELISA KIT (1 x 96 wells)
EA102694 96 Well

Human OMD ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details