Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CD207 sgRNA gene knockout kit - Lentiviral human CD207 sgRNA gene knockout kit (100)
GTR15370276 1 Vial

Lentiviral human CD207 sgRNA gene knockout kit - Lentiviral human CD207 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Nelumnucifoside B
MBS5791329 Inquire

Nelumnucifoside B

Sign In for Pricing
View Details
Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody
TA382107 100 µL

Stanniocalcin 1 (STC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NR4A1, Human
HY-P7S1786 1 Each

NR4A1, Human

Sign In for Pricing
View Details
STNL E013-210x297-PP-CRD/1 AC Signs
815923 Card of 1 Pictogram(s)

STNL E013-210x297-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
Rat Cerebellar degeneion related antigen 1 (CDR1) ELISA Kit
GTR10362303 96 Well

Rat Cerebellar degeneion related antigen 1 (CDR1) ELISA Kit

Sign In for Pricing
View Details