Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR4A1, Human

Product Specifications

Product Name Alternative

NR4A1 Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

90

Smiles

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Molecular Formula

3164 (Gene_ID) P22736-1 (M1-F598) (Accession)

Molecular Weight

Approximately 74 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4-Chlorophenyl) -N-methyl-3- (pyridin-2-yl) propan-1-amine maleate (Chlorphenamine Impurity) (Standard)
HY-Z8616R 1 Each

3- (4-Chlorophenyl) -N-methyl-3- (pyridin-2-yl) propan-1-amine maleate (Chlorphenamine Impurity) (Standard)

Sign In for Pricing
View Details
Marmoset IL-12/IL-23 p40 ELISPOT antibody pair
CT966-20 20 Plates

Marmoset IL-12/IL-23 p40 ELISPOT antibody pair

Sign In for Pricing
View Details
Magic™ Membrane Protein Human GABRA5 (Gamma-aminobutyric acid type A receptor subunit alpha5) Full Length
MPC0513K Each

Magic™ Membrane Protein Human GABRA5 (Gamma-aminobutyric acid type A receptor subunit alpha5) Full Length

Sign In for Pricing
View Details
Monkey Nicotinamide (NAM) ELISA kit
GTR10347935 96 Well

Monkey Nicotinamide (NAM) ELISA kit

Sign In for Pricing
View Details
PGHS-2 monoclonal antibody
MB66226 50ul

PGHS-2 monoclonal antibody

Sign In for Pricing
View Details
EBV Ea-D (1108-1) Alexa Fluor® 647
sc-69679 AF647 200 µg/mL

EBV Ea-D (1108-1) Alexa Fluor® 647

Sign In for Pricing
View Details