Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76)

This Recombinant Human T cell receptor beta variable 7-6 (TVB76) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USB1 Human Pre-designed siRNA Set A
HY-RS15511 1 Set

USB1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
LGR5 Mouse Monoclonal Antibody [Clone ID: OTI11C2]
TA808304 100 µL

LGR5 Mouse Monoclonal Antibody [Clone ID: OTI11C2]

Sign In for Pricing
View Details
CTACK/ CCL27
M10-055-L1000 1000 µg

CTACK/ CCL27

Sign In for Pricing
View Details
Pepinemab Biosimilar (Monoclonal, IgG4, kappa)
A138140 100 µL

Pepinemab Biosimilar (Monoclonal, IgG4, kappa)

Sign In for Pricing
View Details
CCNL2 Protein Vector (Mouse) (pPB-N-His)
PV162951 500 ng

CCNL2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Anti-human CD61/PE antibody
SLM-30192M-PE-01 25 Tests

Mouse Anti-human CD61/PE antibody

Sign In for Pricing
View Details