Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14)

This Recombinant Human T cell receptor beta variable 14 (TVB14) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Heptadecylresorcinol
HY-N2673-01 5 mg

5-Heptadecylresorcinol

Sign In for Pricing
View Details
5-Heptadecylresorcinol
HY-N2673-02 10 mg

5-Heptadecylresorcinol

Sign In for Pricing
View Details
ABCG2 Polyclonal Antibody, APC Conjugated
bs-4780R-APC 100 µL

ABCG2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
MCT5 Polyclonal Antibody, Cy3 Conjugated
bs-18736R-Cy3 100 µL

MCT5 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
TFEB activator 1
MBS3611133-01 2 mg

TFEB activator 1

Sign In for Pricing
View Details
TFEB activator 1
MBS3611133-02 5 mg

TFEB activator 1

Sign In for Pricing
View Details