Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP)

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP) spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25A Polyclonal Antibody
E-AB-70140-01 60 µL

CDC25A Polyclonal Antibody

Sign In for Pricing
View Details
CDC25A Polyclonal Antibody
E-AB-70140-02 120 µL

CDC25A Polyclonal Antibody

Sign In for Pricing
View Details
CDC25A Polyclonal Antibody
E-AB-70140-03 200 µL

CDC25A Polyclonal Antibody

Sign In for Pricing
View Details
3-[[(2S)-2-Pyrrolidinylcarbonyl]amino]benzoic Acid
TRC-P999220-500MG 500 mg

3-[[(2S)-2-Pyrrolidinylcarbonyl]amino]benzoic Acid

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD34 Antibody[4H11]
E-AB-F1324L-01 20 Tests

Elab Fluor® 488 Anti-Human CD34 Antibody[4H11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD34 Antibody[4H11]
E-AB-F1324L-02 100 Tests

Elab Fluor® 488 Anti-Human CD34 Antibody[4H11]

Sign In for Pricing
View Details