Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 271 (TM271), partial

This Recombinant Human Transmembrane protein 271 (TM271), partial spans the amino acid sequence from region 240-385. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 271 TMEM271

UniProt

A0A286YF58

Expression Region

240-385

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNYKSSQARRGRRGRRRGGRALARPRGGSGLRAQPPASRARRGRRGRRGRRLQQRPSEASILSPEESDLAAPGDCAGFAAHHAVSYINVGVLHALDEAGAEVRCGGHPSVELPGYAPSDPDLNASYPYCCRPPCETPRPWETHRAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-APB
SIH-316-50MG 50 mg

2-APB

Sign In for Pricing
View Details
N-Biotinyl Glycine
TRC-B395940-25MG 25 mg

N-Biotinyl Glycine

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS500850 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PDK3 (NM_005391) Human Over-expression Lysate
LY401655 100 µg

PDK3 (NM_005391) Human Over-expression Lysate

Sign In for Pricing
View Details
YES1 Antibody (Biotin)
KB-1974-01 50 μL

YES1 Antibody (Biotin)

Sign In for Pricing
View Details
YES1 Antibody (Biotin)
KB-1974-02 100 µL

YES1 Antibody (Biotin)

Sign In for Pricing
View Details