Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated

This Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1B; EC 3.2.1.1; AMY1B AMY1

UniProt

P0DTE7

Expression Region

16-511

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paqr7 siRNA Oligos set (Rat)
36003176 3x 5 nmol

Paqr7 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit anti-POLR1D Antibody
DL97023A-01 50 µL

Rabbit anti-POLR1D Antibody

Sign In for Pricing
View Details
Rabbit anti-POLR1D Antibody
DL97023A-02 100 µL

Rabbit anti-POLR1D Antibody

Sign In for Pricing
View Details
Neomycin Trisulfate Hydrate (Fradiomycin Trisulfate Hydrate)
MBS6032425-01 100 g

Neomycin Trisulfate Hydrate (Fradiomycin Trisulfate Hydrate)

Sign In for Pricing
View Details
Neomycin Trisulfate Hydrate (Fradiomycin Trisulfate Hydrate)
MBS6032425-02 5x 100 g

Neomycin Trisulfate Hydrate (Fradiomycin Trisulfate Hydrate)

Sign In for Pricing
View Details
DT Cryo-Tags 1.50" x 0.50" & 3/8" spot, Red
DTCR-6000-R 1 Roll

DT Cryo-Tags 1.50" x 0.50" & 3/8" spot, Red

Sign In for Pricing
View Details