Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ACAD9 Antibody Picoband®, FITC Conjugate
A05223-3-FITC 100 µg/Vial

Anti-ACAD9 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Direct Blue 218 (Technical Grade)
TRC-D492970-10G 10 g

Direct Blue 218 (Technical Grade)

Sign In for Pricing
View Details
Mouse Ephrin type-A receptor 1, Epha1 ELISA KIT
ELI-20502m 96 Tests

Mouse Ephrin type-A receptor 1, Epha1 ELISA KIT

Sign In for Pricing
View Details
TRAF3IP2 Rabbit Polyclonal Antibody (HRP)
orb2108609 100 µL

TRAF3IP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GABRG2 Rabbit Polyclonal Antibody
orb323272-01 30 µL

GABRG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABRG2 Rabbit Polyclonal Antibody
orb323272-02 50 μL

GABRG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details