Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3IP2 Rabbit Polyclonal Antibody (HRP)

TRAF3IP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACT1, CIKS, C6orf2, C6orf4, C6orf5, C6orf6, CANDF8, PSORS13

UniProt

O43734

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRAF3IP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_671733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanylyl Cyclase alpha 1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62410R-BF750 100 µL

Guanylyl Cyclase alpha 1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PRIM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37616111 3x 1.0 µg

PRIM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Monkey Tumor Necrosis Factor Receptor Superfamily Member 11A / RANK (TNFRSF11A) ELISA Kit
abx358816 96 Well

Monkey Tumor Necrosis Factor Receptor Superfamily Member 11A / RANK (TNFRSF11A) ELISA Kit

Sign In for Pricing
View Details
SLC5A10 Protein Vector (Mouse) (pPM-C-HA)
44232024 500 ng

SLC5A10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MFI2 Protein Vector (Rat) (pPB-N-His)
PV282031 500 ng

MFI2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Lass2-set siRNA/shRNA/RNAi Lentivector (Mouse)
26320094 4x 500 ng

Lass2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details