Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Otoconin-90 (OC90), Biotinylated

This Recombinant Human Otoconin-90 (OC90), Biotinylated spans the amino acid sequence from region 18-477. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Otoconin-90; Oc90; Phospholipase A2 homolog; OC90 PLA2L

UniProt

Q02509

Expression Region

18-477

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HPLDTPHLPQELPPGLPNNINITFFSGMFKNVESVAEIFDCLGPHFTWLQAVFTNFPVLIQFVNGMKCVAGLCPRDFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLSTEVNCVSKKIICESKDNCEHLLCTCDKAAIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRVVPVEPTDTSLTALSGEEAGHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPAGIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQVMPQLGEMLFCLTSRCPEEFESYGCYCGQEGRGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLRKSLGPLGIGPLHGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Methylbenzofuran-2-carboxylic acid
281646-01 1 g

3-Methylbenzofuran-2-carboxylic acid

Sign In for Pricing
View Details
3-Methylbenzofuran-2-carboxylic acid
281646-02 2 g

3-Methylbenzofuran-2-carboxylic acid

Sign In for Pricing
View Details
3-Methylbenzofuran-2-carboxylic acid
281646-03 5 g

3-Methylbenzofuran-2-carboxylic acid

Sign In for Pricing
View Details
Human FOLH1 / Glutamate carboxypeptidase 2 ELISA Kit
EK21067 Inquire

Human FOLH1 / Glutamate carboxypeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Bloc1s2 Rabbit Polyclonal Antibody (Biotin)
orb2104642 100 µL

Bloc1s2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CHD6 Polyclonal Antibody
BT-AP14938-01 20 µL

CHD6 Polyclonal Antibody

Sign In for Pricing
View Details