Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bloc1s2 Rabbit Polyclonal Antibody (Biotin)

Bloc1s2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BL, Bloc, BLOS2, Bloc1s2a, 2410089B13Rik

UniProt

Q9CWG9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nab1 3'UTR Luciferase Stable Cell Line
TU113800 1.0 mL

Nab1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey Vitamin D Binding protein (VDBP) ELISA Kit
YP-W101470-01 48 Tests

Monkey Vitamin D Binding protein (VDBP) ELISA Kit

Sign In for Pricing
View Details
Monkey Vitamin D Binding protein (VDBP) ELISA Kit
YP-W101470-02 96 Tests

Monkey Vitamin D Binding protein (VDBP) ELISA Kit

Sign In for Pricing
View Details
LOC100504096 3'UTR Luciferase Stable Cell Line
TU111964 1.0 mL

LOC100504096 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-HOXC10 Antibody Picoband®, Dylight594 Conjugate
A09018-1-Dylight594 100 µg

Anti-HOXC10 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
API5 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1252R-BF647 100 µL

API5 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details