Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD1 Mouse Monoclonal Antibody [Clone ID: OTI2D7]
TA811768S 30 µL

MBD1 Mouse Monoclonal Antibody [Clone ID: OTI2D7]

Sign In for Pricing
View Details
OKCA00459-96W - Filariasis Antibody (IgG) (Human) ELISA Kit
OKCA00459-96W 96 Well

OKCA00459-96W - Filariasis Antibody (IgG) (Human) ELISA Kit

Sign In for Pricing
View Details
α-Glucosidase-IN-67
HY-161764 1 Each

α-Glucosidase-IN-67

Sign In for Pricing
View Details
Recombinant FeMo cofactor biosynthesis protein nifB (nifB), partial
MBS1075307 Inquire

Recombinant FeMo cofactor biosynthesis protein nifB (nifB), partial

Sign In for Pricing
View Details
NLK Polyclonal Antibody
RA33578-01 50 µL

NLK Polyclonal Antibody

Sign In for Pricing
View Details
NLK Polyclonal Antibody
RA33578-02 100 µL

NLK Polyclonal Antibody

Sign In for Pricing
View Details