Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ECM1 Antibody
DL99133A-01 50 µL

Rabbit anti-ECM1 Antibody

Sign In for Pricing
View Details
Rabbit anti-ECM1 Antibody
DL99133A-02 100 µL

Rabbit anti-ECM1 Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 7 (FABP7) Rabbit ELISA Kit
D3441 96 Tests

Fatty Acid Binding Protein 7 (FABP7) Rabbit ELISA Kit

Sign In for Pricing
View Details
RFC3, CT (RFC3, Replication factor C subunit 3, Activator 1 38kD subunit, Activator 1 subunit 3, Replication factor C 38kD subunit) (AP) discontinued
040976-AP 200 µL

RFC3, CT (RFC3, Replication factor C subunit 3, Activator 1 38kD subunit, Activator 1 subunit 3, Replication factor C 38kD subunit) (AP) discontinued

Sign In for Pricing
View Details
EPSTI1 ELISA Kit (Human) (OKCD00991)
OKCD00991 96 Well

EPSTI1 ELISA Kit (Human) (OKCD00991)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC61 Antibody
NBP2-92014-0.02mL 0.02 mL

Rabbit Polyclonal CCDC61 Antibody

Sign In for Pricing
View Details