Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCDIN3D Double Nickase Plasmid (h2)
sc-406497-NIC-2 20 µg

BCDIN3D Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse Monoclonal FLI1 Antibody (FLI1/3183) [Alexa Fluor 350]
NBP3-08652AF350 100 µL

Mouse Monoclonal FLI1 Antibody (FLI1/3183) [Alexa Fluor 350]

Sign In for Pricing
View Details
Zinc finger protein 608 (ZNF608) Human ELISA Kit
I3753 96 Tests

Zinc finger protein 608 (ZNF608) Human ELISA Kit

Sign In for Pricing
View Details
NUP88 Peptide - middle region
orb1998407 100 µg

NUP88 Peptide - middle region

Sign In for Pricing
View Details
Fibroblast Growth Factor-23 C-Terminal Human Recombinant
rAP-2191 1 Each

Fibroblast Growth Factor-23 C-Terminal Human Recombinant

Sign In for Pricing
View Details
MEG1 Rabbit Polyclonal Antibody (BF750)
orb2428339 100 µL

MEG1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details