Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP88 Peptide - middle region

NUP88 Peptide - middle region

Product Specifications

UniProt

Q99567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307582.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPSRYHCTHEAGVHSVGLTWIHKLHKFLGSDEEDKDSLQELSTEQKCFVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pin4 (NM_027181) Mouse Tagged Lenti ORF Clone
MR220119L3 10 µg

Pin4 (NM_027181) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-SIRT6 (Ser338) Polyclonal Antibody, Cy3 Conjugated
bs-5634R-Cy3 100 µL

Phospho-SIRT6 (Ser338) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
1,2,4-Triazole-3-carboxylic acid
290563-01 5 g

1,2,4-Triazole-3-carboxylic acid

Sign In for Pricing
View Details
1,2,4-Triazole-3-carboxylic acid
290563-02 10 g

1,2,4-Triazole-3-carboxylic acid

Sign In for Pricing
View Details
1,2,4-Triazole-3-carboxylic acid
290563-03 25 g

1,2,4-Triazole-3-carboxylic acid

Sign In for Pricing
View Details
1,2,4-Triazole-3-carboxylic acid
290563-04 50 g

1,2,4-Triazole-3-carboxylic acid

Sign In for Pricing
View Details