Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated

This Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSPG4 Recombinant Rabbit monoclonal Antibody
HA723245 100 µL

Human CSPG4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL
BNC400200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Doc2b activation kit by CRISPRa
GA201114 1 Kit

Mouse Doc2b activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human/Cynomolgus VEGFA/VEGF165 Protein
PKSH031978-01 20 µg

Recombinant Human/Cynomolgus VEGFA/VEGF165 Protein

Sign In for Pricing
View Details
Recombinant Human/Cynomolgus VEGFA/VEGF165 Protein
PKSH031978-02 100 µg

Recombinant Human/Cynomolgus VEGFA/VEGF165 Protein

Sign In for Pricing
View Details
Solution Reservoir
P8010 300 Units/Case

Solution Reservoir

Sign In for Pricing
View Details