Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKR-4 rabbit pAb
ES4707-01 50 µL

CKR-4 rabbit pAb

Sign In for Pricing
View Details
CKR-4 rabbit pAb
ES4707-02 100 µL

CKR-4 rabbit pAb

Sign In for Pricing
View Details
eRF1 (ETF1) (NM_004730) Human Tagged Lenti ORF Clone
RC220387L1 10 µg

eRF1 (ETF1) (NM_004730) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CA8 Antibody
KC-36859-01 50 μL

CA8 Antibody

Sign In for Pricing
View Details
CA8 Antibody
KC-36859-02 100 µL

CA8 Antibody

Sign In for Pricing
View Details
CA8 Antibody
KC-36859-03 1 mL

CA8 Antibody

Sign In for Pricing
View Details