Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2)

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIFC3 antibody
FNab04574 100 µg

KIFC3 antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 18 (T410) KRT18 Antibody
A01357T410 100 µL

Anti-Cytokeratin 18 (T410) KRT18 Antibody

Sign In for Pricing
View Details
FHIT 3'UTR Luciferase Stable Cell Line
TU007966 1.0 mL

FHIT 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PME52 Antibody
orb793384 2 mg

PME52 Antibody

Sign In for Pricing
View Details
Anti-Catalase Antibody, Rabbit Polyclonal
MBS8106167-01 0.1 mL

Anti-Catalase Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Catalase Antibody, Rabbit Polyclonal
MBS8106167-02 5x 0.1 mL

Anti-Catalase Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details