Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ribosomal subunit protein mS33 (RT33)

This Recombinant Human Small ribosomal subunit protein mS33 (RT33) spans the amino acid sequence from region 2-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ribosomal subunit protein mS33; 28S ribosomal protein S33, mitochondrial; MRP-S33; S33mt; MRPS33 CGI-139 PTD003

UniProt

Q9Y291

Expression Region

2-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNT3 (NM_014256) Human Over-expression Lysate
LC415403 20 µg

B3GNT3 (NM_014256) Human Over-expression Lysate

Sign In for Pricing
View Details
Hist1h4m sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3102807 1.0 µg DNA

Hist1h4m sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
DDA1 Peptide - N-terminal region
orb1999864 100 µg

DDA1 Peptide - N-terminal region

Sign In for Pricing
View Details
Anti-CHM Antibody Picoband® (HRP Conjugate)
A00814-1-HRP 100 µg/Vial

Anti-CHM Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Inositol Hexakisphosphate Kinase 2 (IP6K2) CytoSection
TS409533P5 25 Slides

Inositol Hexakisphosphate Kinase 2 (IP6K2) CytoSection

Sign In for Pricing
View Details
PSD CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37898156 3x 1.0 µg DNA

PSD CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details