Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDA1 Peptide - N-terminal region

DDA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PCIA1, C19orf58

UniProt

Q9BW61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076955.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Oryzias latipes (Japanese rice fish) hcea Antibody FITC Conjugated
DZ41882-FITC 200 µL/Vial

Anti-Oryzias latipes (Japanese rice fish) hcea Antibody FITC Conjugated

Sign In for Pricing
View Details
Chicken Lymphocyte Antigen 96 ELISA Kit
MBS751724-01 48 Well

Chicken Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Chicken Lymphocyte Antigen 96 ELISA Kit
MBS751724-02 96 Well

Chicken Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Chicken Lymphocyte Antigen 96 ELISA Kit
MBS751724-03 5x 96 Well

Chicken Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Chicken Lymphocyte Antigen 96 ELISA Kit
MBS751724-04 10x 96 Well

Chicken Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Human COL3a1 (Collagen Type III Alpha 1) ELISA Kit
MBS8801900-01 48 Well

Human COL3a1 (Collagen Type III Alpha 1) ELISA Kit

Sign In for Pricing
View Details