Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CR1 Antibody [E11], Rabbit IgG
24-658 0.2 mg

CR1 Antibody [E11], Rabbit IgG

Sign In for Pricing
View Details
KMO Peptide - N-terminal region
orb2004944 100 µg

KMO Peptide - N-terminal region

Sign In for Pricing
View Details
Usp5 3'UTR GFP Stable Cell Line
TU171684 1.0 mL

Usp5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Pgam2 shRNA (UAS) - Lentiviral mouse Pgam2 shRNA (UAS, GFP) (100)
GTR15253605 1 Vial

Lentiviral mouse Pgam2 shRNA (UAS) - Lentiviral mouse Pgam2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Olr1686 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV627464 1.0 µg DNA

Olr1686 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TBC1D8 (TBC1 Domain Family Member 8, AD 3, Vascular Rab-GAP/TBC-containing Protein, VRP) (AP) discontinued
134240-AP 100 µL

TBC1D8 (TBC1 Domain Family Member 8, AD 3, Vascular Rab-GAP/TBC-containing Protein, VRP) (AP) discontinued

Sign In for Pricing
View Details